SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A6TJU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6TJU7
Domain Number 1 Region: 55-360
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.41e-27
Family Phosphate binding protein-like 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A6TJU7
Sequence length 361
Comment (tr|A6TJU7|A6TJU7_ALKMQ) TRAP transporter solute receptor, TAXI family {ECO:0000313|EMBL:ABR46465.1} KW=Complete proteome; Reference proteome OX=293826 OS=Alkaliphilus metalliredigens (strain QYMF). GN=Amet_0230 OC=Alkaliphilus.
Sequence
MKKRGFLLAIAFMLAIGLLTGCAGTEPEAPTDSTPDEAVEENDESQAAGLTDPVRLVFST
QDLGTSFNSMTNAFNTVFMPELPRGSSIDVETTSPGGIAASYIISAEVADLTIGNTAPAN
WATSEGIDDRGVAEGVASLGGGFDEPVLVVIFTEAFQKRTGFTTLEEVIEAQHPVRVATK
ATGSFGEMSANKVLSLFDVTYDDIKSWGGDFTLTSSSNVVDMLRDNRADMTIDHTNINQP
NYVELSMTTPLYYVQLQDETLDRLHEMGYAYQDIAEGSFNNYVKEDIKTVGSPTALLVRE
DMDEEVAYTLTEAMAEGKSKLVTSFAAFEAFDPTKAWEPANAGAPLHPGAERYYREMGYM
K
Download sequence
Identical sequences A6TJU7
WP_011971374.1.32322 293826.Amet_0230 gi|150388075|ref|YP_001318124.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]