SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A6TM21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6TM21
Domain Number 1 Region: 42-274
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.39e-31
Family Phosphate binding protein-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A6TM21
Sequence length 287
Comment (tr|A6TM21|A6TM21_ALKMQ) Extracellular solute-binding protein, family 1 {ECO:0000313|EMBL:ABR47239.1} KW=Complete proteome; Reference proteome OX=293826 OS=Alkaliphilus metalliredigens (strain QYMF). GN=Amet_1022 OC=Alkaliphilus.
Sequence
MEIRKWHVLLMTVLLVAMTVIGCSQGAIDDHKESGQSTGNSILLATTTSTENSGLLDDIL
PILTEDTGVEVKVVAVGTGQALQMGKDGEVDVILAHSKKAEDEFVQEDHGIQRFDVMYND
FVLIGPKDDPADIGVLAKNDILKALSIFQNTEETFLSRGDDSGTHKMELQLWETLGIDPK
GRWYVSAGQGMGAVIQMTNEMLGYTLSDRATYLSMKHNLDLDIILEGDGMLFNQYGVIAV
NPNKNVQINYEGAMILIEWLLSEKGQGLIGEFGQSEFGQSLFIPNAK
Download sequence
Identical sequences A6TM21
WP_012062281.1.32322 293826.Amet_1022 gi|150388849|ref|YP_001318898.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]