SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A6TND8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6TND8
Domain Number 1 Region: 54-508
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.42e-100
Family Phosphate binding protein-like 0.0000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A6TND8
Sequence length 523
Comment (tr|A6TND8|A6TND8_ALKMQ) Extracellular solute-binding protein, family 5 {ECO:0000313|EMBL:ABR47706.1} KW=Complete proteome; Reference proteome OX=293826 OS=Alkaliphilus metalliredigens (strain QYMF). GN=Amet_1512 OC=Alkaliphilus.
Sequence
MSWKQWKKGMVMIVVGMMMLSLIGCGTDTSQEEVETVGSNNETEANKEKEDVVLKLGGGD
WGYPSPYLHYSRGPGIYKMQLIFDSLLEYGEEGLIPWLAKEWEVSEDGLNYIFTLQEGVK
WHDGQVLTAEDVKFSFEFSEKHPPVQNYIMVGDQSIIKEIEILEDGRVKFTFAEKNATIL
EKIGTVRIIPEHIWSEVEDPESFQDERAVIGCGPYTLTNYSKEHSTYEFTAFKDYWGPKQ
KVEKIQFVPVSDEIMAFENEEIDQIGVGADLLDRYMGDPTFTVLENPAFWGYRLTLNMEK
NPIFKEKEIRQAIAYGIDQQEMVDKVERGAAVVASAGYLPEDHVWYNPAVKKYPFDEDKA
KTLLGDEKVSFQLLTGNSNAEVRIAELMKISLDKVGIEVNVQSADTKTRDNAIVTGNYEV
ALTGHGGWGNDADILRTRYSDILGYDNEEINKLALEQLQELDTEKRKEMIFSLQELISEE
MPMIPIYNTTGYTVYRPSTYDGWMYMFDHHNVSHGKLSYLERK
Download sequence
Identical sequences A6TND8
gi|150389316|ref|YP_001319365.1| 293826.Amet_1512 WP_012062744.1.32322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]