SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A6U9N6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6U9N6
Domain Number 1 Region: 11-306
Classification Level Classification E-value
Superfamily Indigoidine synthase A-like 5.36e-116
Family Indigoidine synthase A-like 0.00000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A6U9N6
Sequence length 309
Comment (tr|A6U9N6|A6U9N6_SINMW) Pseudouridine-5'-phosphate glycosidase {ECO:0000256|HAMAP-Rule:MF_01876} KW=Complete proteome OX=366394 OS=Sinorhizobium medicae (strain WSM419) (Ensifer medicae). GN=Smed_1524 OC=Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium.
Sequence
MTNPSSSSLTIDYSDEVAAAKQRGAPIVALESTIITHGMPYPGNLDMARSVETIIREQGA
VPATIAVIHGVLHIGLDGAELEALSTTQGAMKLSRADLAFAIAERRTGATTVAATMIAAA
RAGIRVFATGGIGGVHRGAEQSFDISADLDELARTGVIVVCAGAKAILDIPKTLEVLESR
GVPVVTYDSENFPAFWSRESGLKSPLMLNSPAAIASFQRTRELLGIEGGMLVANPVPEES
EIPREEMEIYITRAIDNAASEGITGKAVTPYLLDNLFRLTDGRSLETNIALVENNARLAA
EIAVALAMK
Download sequence
Identical sequences A6U9N6
gi|150396734|ref|YP_001327201.1| WP_011975675.1.29075 WP_011975675.1.61285 WP_011975675.1.7720 YP_001327201.1.44884 366394.Smed_1524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]