SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A6UCA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6UCA3
Domain Number 1 Region: 4-243
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.08e-78
Family ABC transporter ATPase domain-like 0.000000635
Further Details:      
 
Domain Number 2 Region: 237-353
Classification Level Classification E-value
Superfamily MOP-like 1.09e-19
Family ABC-transporter additional domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A6UCA3
Sequence length 364
Comment (tr|A6UCA3|A6UCA3_SINMW) ABC transporter related {ECO:0000313|EMBL:ABR61283.1} KW=Complete proteome OX=366394 OS=Sinorhizobium medicae (strain WSM419) (Ensifer medicae). GN=Smed_2451 OC=Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium.
Sequence
MASIRAEKLVKRYGAFQAVHGIDFEIADGEFVAILGPSGCGKSSTMRMIAGLETLTEGAI
YFDGKRVNDVRARDRNVAMSFESYALYPTISIYENIAFPLRSANVDNREIDRQVRDIAEK
MELTPLLDLKPKELSSGQAQRVGLARALVRNPAVFLLDEPISHLDTRQRYRMRRFIKSLH
QKFDYTMIYVTHDQEEALALAERVMVMSDGEIQQMAVPDEVYARPRNAFVAGFVGEPPIN
FFDCRVAAANGGWGIEFEGRKLALPERLHAAAQAIGDGGLAAIRPHFLSIGGDGPLHVDG
KVFITEELQDQNLIFVDVGDTRFTLVAHPSVTPRRGEAVRVSIDPEHLLLFPRSQAGKIE
SLVA
Download sequence
Identical sequences A6UCA3
YP_001328118.1.44884 366394.Smed_2451 gi|150397651|ref|YP_001328118.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]