SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A6UCL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6UCL3
Domain Number 1 Region: 207-352
Classification Level Classification E-value
Superfamily CBS-domain pair 6.96e-33
Family CBS-domain pair 0.0032
Further Details:      
 
Domain Number 2 Region: 349-430
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.55e-20
Family CorC/HlyC domain-like 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A6UCL3
Sequence length 434
Comment (tr|A6UCL3|A6UCL3_SINMW) Uncharacterized protein {ECO:0000313|EMBL:ABR61393.1} KW=Complete proteome OX=366394 OS=Sinorhizobium medicae (strain WSM419) (Ensifer medicae). GN=Smed_2563 OC=Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium.
Sequence
MTDVILAFLADYWLSLLSVICLLVISAFFSGSETALTAASRSRMHTLENNGDERAGIVNN
LIERRDRLIGTLLIGNNLVNILASSLTTSLLIGLFGDSGVAIATVAMTVLLVIFSEVLPK
SWAIASPDRFALAVAPLVRPFVVVVGPISSLVNAIVRRILHLFGVNLSSDLPMLSAHEEL
RGAVNLLHREGSVIKADRDRLGGVLDLGELEVSDIMIHRTSMRAINADDPPETCVREILE
SPFTRLPLWRGSADNIIGVVHSKDLLRALAEPNVEPETLDIVKIAQKPWFVPDSTNLKDQ
LNAFLRRKLHLAIVVDEYGQVQGLVTLEDILEEIVGDIADEHDIDIQGVRQEADGSIVVD
GSVPIRDLNRALDWSLPDEEATTVAGLVIHESKSIPEERQAFTFYGKRFTVMKRVKNRIT
KLRIRAAEDEGQVG
Download sequence
Identical sequences A6UCL3
gi|150397761|ref|YP_001328228.1| WP_012066784.1.29075 WP_012066784.1.61285 WP_012066784.1.7720 YP_001328228.1.44884 366394.Smed_2563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]