SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A6UEQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6UEQ5
Domain Number 1 Region: 110-228
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.44e-25
Family Aromatic dioxygenase reductase-like 0.0049
Further Details:      
 
Domain Number 2 Region: 7-104
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.61e-23
Family Ferredoxin reductase FAD-binding domain-like 0.0046
Further Details:      
 
Domain Number 3 Region: 215-314
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.31e-20
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A6UEQ5
Sequence length 321
Comment (tr|A6UEQ5|A6UEQ5_SINMW) Ferredoxin {ECO:0000313|EMBL:ABR62135.1} KW=Complete proteome OX=366394 OS=Sinorhizobium medicae (strain WSM419) (Ensifer medicae). GN=Smed_3313 OC=Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium.
Sequence
MSGGTEIPVRVTKVTPVAHRIKRFRFERLDGRPMPYFSGGAHVIVSMNDNGHLRRNAYSL
MSPPYDCSAYEISVLHVDDSRGGSSFMHEKVREGDEMRVSHPVNLFQPDWRGRKHLLIAG
GIGITPFIAMMEQFSREGAQFELHYAIRSRDRGAYCEDLVAHYGRHRVKIYCDAEDNRIP
VARLLDSQPLGTHLYVCGPAGLIDGVLKSGLESGWPEQNLHSERFLSSQPGKPFSIELTR
SGKTVHVGHHESMLEAIESAGVDAPFLCRGGACGQCETRVALCDGKLLHNDVYLTDEEKA
SGRKVMLCVSRFEGKALHLDL
Download sequence
Identical sequences A6UEQ5
366394.Smed_3313 gi|150398503|ref|YP_001328970.1| WP_012067516.1.7720 YP_001328970.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]