SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A6UH84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6UH84
Domain Number 1 Region: 7-204
Classification Level Classification E-value
Superfamily Aromatic compound dioxygenase 6.41e-60
Family Aromatic compound dioxygenase 0.00000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A6UH84
Sequence length 204
Comment (tr|A6UH84|A6UH84_SINMW) Protocatechuate 3,4-dioxygenase, alpha subunit {ECO:0000313|EMBL:ABR63014.1} KW=Complete proteome OX=366394 OS=Sinorhizobium medicae (strain WSM419) (Ensifer medicae). GN=Smed_4209 OC=Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium.
Sequence
MAQDLGYLKETASQTAGPYVHIGLTPNFCGIGGVYEADLGASMVNDRTLGQRITVTGRVI
DGAGMPLKDALLEIWQADAAGLYNSPSERRGAADPNFAGWGRSPTGADDGMFTFETVKPG
RVPFHDGRLMAPHISFWIVARGINIGLHTRMYFPDEAVANAADPLLARIEHRHRAETLVA
AGRTPNYVFDIHLQGEKETVFLDI
Download sequence
Identical sequences A6UH84
gi|150376351|ref|YP_001312947.1|NC_009620 366394.Smed_4209 gi|150376351|ref|YP_001312947.1| WP_011969836.1.7720 YP_001312947.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]