SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A6UHN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6UHN6
Domain Number 1 Region: 298-500
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 3.14e-49
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000273
Further Details:      
 
Domain Number 2 Region: 805-1027
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 5.1e-41
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000107
Further Details:      
 
Domain Number 3 Region: 565-671
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.62e-26
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00066
Further Details:      
 
Domain Number 4 Region: 39-133
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.88e-24
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000653
Further Details:      
 
Domain Number 5 Region: 137-183,276-332
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.96e-24
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0024
Further Details:      
 
Domain Number 6 Region: 184-273
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 3.53e-21
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00025
Further Details:      
 
Domain Number 7 Region: 722-806
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 1.57e-20
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A6UHN6
Sequence length 1065
Comment (tr|A6UHN6|A6UHN6_SINMW) Efflux pump membrane transporter {ECO:0000256|RuleBase:RU364070} KW=Complete proteome OX=366394 OS=Sinorhizobium medicae (strain WSM419) (Ensifer medicae). GN=Smed_4361 OC=Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium.
Sequence
MISEIFIDRPRFAAVISIVLTLAGLIALTRLPVAQFPDIVPPQVSITASYPGAGADVVEA
TVAQPIESKVVGVDDMLYMKSTSGADGTYSLTVTFAVGTDPDIATVNVQNRVALAEPVLP
AEVKQSGVSVQKRSSSLMQVIAIHGENDEFDNLFLSNYATINVLDTIKRVPGVGDATLFG
AQDYSMRIVLDIDRLTNLGLTPTDVINALKAQNVQAAIGRIGAQPMTDDPLFQLNIQTQG
RLTDPAQFGDVVLRAGADGSFVRIRDVAHVELGSVSSDSTARINGKPVAMIGTYQAPGAN
ALAATEGVQQALERLSAAFPEGLTYSVSYDTSDFVQASVENVEHTLLEAFALVIIVVFLF
LGNWRATLIPLIAVPVALVGTFAVILAMGFSLNTVSLLALVLAIGIVVDDAIVVVENVER
VMEENPGMSAAEASRLAMGEITGAIVAITLVLLSVFVPVAFIPGLSGQLFQQFAVAVSVS
MVISAINALTLSPALCAILLKPHHGPKRGVLGWISRGIDRTRNGYAHLAGGIARRAILGL
VLLAVAIGASGWLFRIVPTGFLPSEDQGAFFAEIRLPEGASFNRTDAVVRQVESLLGSIE
GVANVTTVTGYSFLDGIAKSSSAFAIVTMKPFAERESETASVNAAIATVMAQGAAIRNAQ
VFAFNLPPIIGLGTGSGFEYQLLDLQGRSPAELAATAGGLMVAANQNPQLGPTFSTYSAS
SPQLYLDLDRDRLQALGVSVSDLFATLQGTLGSYYVNDFNLFGRSWKVTMQAAETDRDAV
EDISRLHVRNAAGDMVPVASVARVNYIVGPQSIVRYNNYRSITLNGQPAPGVSSGQALAA
MEQISAATLPPGYSFEWTGTALQELEAAGQTTVILALAVFFAYLFLVALYESWTIPIPVL
LSVSVGVAGALVAVLLAGLSFDIYAQIGLVVLIALASKNAILIVEFAKFQREKGVPIVDA
AVEGARTRFRAVMMTSFAFIVGLVPLVTAEGAGMLSRRAVGTGVAGGMLAASLLGIFIIP
ALYVVFQWLRERGHKLAGLSSHAAVEAPRKGELEESIERDRNVAD
Download sequence
Identical sequences A6UHN6
gi|150376503|ref|YP_001313099.1| YP_001313099.1.44884 gi|150376503|ref|YP_001313099.1|NC_009620 366394.Smed_4361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]