SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A6UI09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6UI09
Domain Number 1 Region: 6-303
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.06e-84
Family PA1517-like 0.00000000634
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A6UI09
Sequence length 309
Comment (tr|A6UI09|A6UI09_SINMW) Chitin deacetylase {ECO:0000313|EMBL:ABR63289.1} KW=Complete proteome OX=366394 OS=Sinorhizobium medicae (strain WSM419) (Ensifer medicae). GN=Smed_4489 OC=Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium.
Sequence
MNENSYPRDFVGYGRRPPEARWPGDANIAVQFVLNYEEGGESCILDGDPASECLLSEIVG
AQPWAGQRNLNMESIYEYGARAGFWRLWRMFTSRGVTLTVYGVTLAMARNPEAVAAMKEA
GWEIASHGLRWLEYKDVPEEVERQHIREVVRLHTELTGERPLGIYQGKPSANTLKLVLEE
GGFLYSCDSYADELPYWVPGRTPDNPHLIIPYTLDANDMRFATSQGFNSGDQFFTYLKDT
FDVLYAEGKEGSPKMMNVGLHCRLVGRPGRAAALARFIDYVTSHDKVWVPRRIDIARHWY
EHHKPTEAR
Download sequence
Identical sequences A6UI09
366394.Smed_4489 gi|150376626|ref|YP_001313222.1|NC_009620 gi|150376626|ref|YP_001313222.1| WP_012061422.1.29075 WP_012061422.1.31871 WP_012061422.1.61285 WP_012061422.1.89664 YP_001313222.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]