SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A6UI31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6UI31
Domain Number 1 Region: 22-66,98-321
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 8.34e-31
Family NodB-like polysaccharide deacetylase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A6UI31
Sequence length 332
Comment (tr|A6UI31|A6UI31_SINMW) Uncharacterized protein {ECO:0000313|EMBL:ABR63311.1} KW=Complete proteome OX=366394 OS=Sinorhizobium medicae (strain WSM419) (Ensifer medicae). GN=Smed_4511 OC=Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium.
Sequence
MIRISLALSVALFPALALADPPSARQLPKQLVVISFDGAHDNALWQKSLTMGKRTGARFT
YFLSCTFLMTRADGKQTYRAPGQKPGRSNVGFAQSREDIAMRAGHVWQAHLAGHEIGSHA
CGHFDGKDWSKADWASEFSAFRAALANAWKRAGKPEAEPEGWADFAQGGIKGFRAPYLSL
SDGLVPALKTFGFSYDASLVTKGPGWPSFADGLIRFGLPLIPEGPSHRPVIGMDYNLFVR
HSMGVENSRDSARFEERTLAAFRNAFRKEYEGERIPLQLGFHFVEMNGGAYWRALDGFLS
ETCSKPDVACVSYAEALPLIENARKKADRSAF
Download sequence
Identical sequences A6UI31
gi|150376648|ref|YP_001313244.1|NC_009620 gi|150376648|ref|YP_001313244.1| YP_001313244.1.44884 366394.Smed_4511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]