SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A6UJC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6UJC0
Domain Number 1 Region: 183-424
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.19e-70
Family D-glucarate dehydratase-like 0.00000012
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.17e-39
Family Enolase N-terminal domain-like 0.0000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A6UJC0
Sequence length 425
Comment (tr|A6UJC0|A6UJC0_SINMW) Mandelate racemase/muconate lactonizing protein {ECO:0000313|EMBL:ABR63750.1} KW=Complete proteome OX=366394 OS=Sinorhizobium medicae (strain WSM419) (Ensifer medicae). GN=Smed_4969 OC=Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium.
Sequence
MTRITDLRVFDLRFPTSASLDGSDAMNPDPDYSAAYVILDTDRPGLAGHGLTFTIGRGND
VCCMAIQAMRHLVVGQDIGDILKHPGRFWRHLTSDSQLRWIGPEKGAIHLATGAIVNAIW
DLLAKDAGKPVWRLVSEMSAEEIADIVDYRYITDVLTRDEAIEILRRAETGKADRIAALE
KEGYPCYTTSAGWLGYDDEKLRRLAQEAVDAGFNHIKMKVGRDLADDMRRLRIAREVIGP
DRYLMIDANQVWEVGEAIDWVQKLAFAKPFFIEEPTSPDDVAGHRKIREAIGPVKVATGE
MCQNRIMFKQFIAEGAIDIVQIDSCRMGGLNEVLAVLLIAAKYGLPVWPHAGGVGLCEYV
QHLSMIDYVAVSGTKDGRVIEYVDHLHEHFLDPCVISDAAYMPPSRPGFSIEMKEKSIED
YTFRG
Download sequence
Identical sequences A6UJC0
gi|150377087|ref|YP_001313683.1| gi|150377087|ref|YP_001313683.1|NC_009620 366394.Smed_4969 WP_012061878.1.61285 YP_001313683.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]