SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A6UK12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6UK12
Domain Number 1 Region: 231-280
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000139
Family AraC type transcriptional activator 0.011
Further Details:      
 
Domain Number 2 Region: 283-330
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000184
Family AraC type transcriptional activator 0.014
Further Details:      
 
Domain Number 3 Region: 87-212
Classification Level Classification E-value
Superfamily Regulatory protein AraC 0.0000445
Family Regulatory protein AraC 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A6UK12
Sequence length 331
Comment (tr|A6UK12|A6UK12_SINMW) Helix-turn-helix-domain containing protein AraC type {ECO:0000313|EMBL:ABR63992.1} KW=Complete proteome OX=366394 OS=Sinorhizobium medicae (strain WSM419) (Ensifer medicae). GN=Smed_5215 OC=Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium.
Sequence
MEDMKASRRKALPRIPILIGGTLHIPPAVEEKTTPPERTSPLGLEQYIAGRTLVSGDGPA
WDDMFVQVYSRLKKQEPFLVPAVAEPLIVWVISGEAIVEEREIDRDWVTNTVTVGDFFLT
RSPTPYEMRWRATGAAPFQVMHLYLSVPLFERVAKDLLGRAARPALRDVSGGKDEQLSHL
LALIHQELTAEGKGSQLFIQGLAQSLAVHLIRNYASNGSEGGRQTALPGFKLRRAVAYLE
EHLAEPFNLAKLSEAVGMSEFHFSRLFKKATGLSPSRYFIRQRVARAQLLLQETDTSIIK
IGMSVGYSSPSHFAQVFRRETGLPPSHYRRG
Download sequence
Identical sequences A6UK12
gi|150377330|ref|YP_001313925.1| 366394.Smed_5215 WP_011970101.1.29075 YP_001313925.1.44884 gi|150377330|ref|YP_001313925.1|NC_009621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]