SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A6W036 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6W036
Domain Number 1 Region: 120-283
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.62e-44
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00058
Further Details:      
 
Domain Number 2 Region: 409-548
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.27e-32
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00088
Further Details:      
 
Domain Number 3 Region: 1-126
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 8.18e-31
Family Duplicated SiR/NiR-like domains 1 and 3 0.01
Further Details:      
 
Domain Number 4 Region: 252-276,315-421
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.42e-22
Family Duplicated SiR/NiR-like domains 1 and 3 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A6W036
Sequence length 552
Comment (tr|A6W036|A6W036_MARMS) Sulfite reductase (Ferredoxin) {ECO:0000313|EMBL:ABR72065.1} KW=Complete proteome; Reference proteome OX=400668 OS=Marinomonas sp. (strain MWYL1). GN=Mmwyl1_3156 OC=Oceanospirillaceae; Marinomonas.
Sequence
MYRYDEYDRALVNERVEEFRDQVARRMSGELTEDEFLPLRLQNGLYLQKHAYMMRVAIPY
GALSSDQMRGLAVIANEFDRGYGHFTTRQNIQFNWIELADTPDILAHLASIDMHAIQTSG
NCVRNVTTEAYAGVAPDEEYDPRIFAEIIRQWATVNPEFLFLPRKFKIAVSSSKEDRAAV
RMHDIGLYLYRDEEEILRFQVMVGGGLGRTPFLNKAVKEDLHWSEVLSYIEAVLRVFNRY
GRRDNKYKARIKILVNSLGVDAFREEVEAEWLQIREGFSTLTDDELSRVASQFLSPLYKT
LDDTDLRYGNHIASNDEFASWVSRSVKPHKVSGYASVVISTKFPTNTPGDLNAEQMQRIA
DLADLYGFGVIRIAHEQNVVLPDIPKKYLFNVWSSLCEVGLALPNVGLVSDMIVCPGASY
CSLATAHSFPVAKKVAEAYSIEEQLEVGDISINLSGCINACAHHHIGNIGILGLNKSGED
YYQITIGGAQGKDSQIGKVIGPAVSEDVLPRVVKNITNAYLANRDESETFHETFLRIGLE
PFKLAAYESVGA
Download sequence
Identical sequences A6W036
400668.Mmwyl1_3156 gi|152997165|ref|YP_001342000.1| WP_012070836.1.45605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]