SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A6W8G8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6W8G8
Domain Number 1 Region: 1-302
Classification Level Classification E-value
Superfamily Phase 1 flagellin 3.92e-58
Family Phase 1 flagellin 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A6W8G8
Sequence length 302
Comment (tr|A6W8G8|A6W8G8_KINRD) Flagellar hook-associated protein 3 {ECO:0000313|EMBL:ABS03107.1} KW=Complete proteome; Reference proteome OX=266940 OS=SRS30216). GN=Krad_1621 OC=Kineococcus.
Sequence
MLGRVTQRSIATNALTNLQNTQTRMAKLQEQITSGNSLPKGSEDSVRAAAALRLNDQIAV
NTENGRNLDEARAWMVTQEPALESTTKALQKVRELTVRASNGTFDATARKAIAAEITALK
ETILGDANTQYQGRAVFAGTSAGTVAYDATTYASNDDTNTTVTPAVGVVTRTVSPGVHMQ
VNISGNSVYGSGNDSLFAELDTLAQKITDGDPTAAASLSTIDGRITKATNAMATIGARTN
QLDHAEEVNANQLAYLEAQLNDVQGVDPAKAYVEFTQQNVAYQAALQVTAKTVQTSLLDF
LR
Download sequence
Identical sequences A6W8G8
gi|152965587|ref|YP_001361371.1| WP_011981754.1.7041 266940.Krad_1621 2005137957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]