SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A6WGH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A6WGH5
Domain Number 1 Region: 61-103,134-185,226-416
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 2.09e-73
Family Acetamidase/Formamidase-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A6WGH5
Sequence length 418
Comment (tr|A6WGH5|A6WGH5_KINRD) Acetamidase/Formamidase {ECO:0000313|EMBL:ABS05914.1} KW=Complete proteome; Reference proteome OX=266940 OS=SRS30216). GN=Krad_4455 OC=Kineococcus.
Sequence
MAPHPLPPARRSLLRAAAGVSAGLGALTATATSAAAHRPVRVLQPGVLQPGRGPRRGVYV
PSVPGNVLWGRLPNRDTEPSVVVASGAVVTLDTVSHEGILEDQGKDPRGYFSGFGVAPRD
VLDDAAAIAASTPHDGPGPHVVNRPVAVTGALPGDVLKVEVLDLALRVPYGVISNRHGKG
ALPGELPERWEGDPALAEYFNVGGNVSVFTSVATSGGDLVGALPGPVPVRFPLAPFLGTM
GVARDTSALVDSVPPTDAGGNIDIKDLVVGSTLYLPVRVPGAMFFVGDPHMAQGDGEVAL
TAMEGSLRATVRLTVVRPGEGGAPQQTARTPFAETPEHWIPVGLSDPDGPGGGAQGTDLG
VAMRDAVRHALDFLTTDLGVPGPVAYAYLSAATDFHVSQVVDRTVGVHATIRKSDFPR
Download sequence
Identical sequences A6WGH5
gi|152968394|ref|YP_001364178.1| WP_012085779.1.7041 266940.Krad_4455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]