SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A7B8X8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7B8X8
Domain Number 1 Region: 7-215
Classification Level Classification E-value
Superfamily CutC-like 1.29e-44
Family CutC-like 0.0000826
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A7B8X8
Sequence length 229
Comment (tr|A7B8X8|A7B8X8_9ACTO) Copper homeostasis protein CutC {ECO:0000256|HAMAP-Rule:MF_00795} KW=Complete proteome OX=411466 OS=Actinomyces odontolyticus ATCC 17982. GN=ACTODO_00078 OC=Actinomyces.
Sequence
MAAVTTVEICVEDAVGVRRARDGGADRIEICTDLSCGGLTPAFDEVAAALEVAPAGGVQV
LVRPRPGDFVHTREEVDRIASDIMTLSSIGRGSDVRLGFVVGVITRDGQIDVNAAARLRD
TAEDAPLTFHRGFDQVADQDRGLDVLMELGYDRVLTTGGDPAVAQPDALARLVERGGDDI
IILVSGGLRAHNVAEVVAASGAREVHMRAPGTSGTDQAEVERIVAALHG
Download sequence
Identical sequences A7B8X8
ACTODO_00078 WP_003790036.1.82230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]