SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A7I7K8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7I7K8
Domain Number 1 Region: 3-76,166-340
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.26e-67
Family Bacterial dinuclear zinc exopeptidases 0.0000134
Further Details:      
 
Domain Number 2 Region: 66-174
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 1.11e-33
Family Aminopeptidase/glucanase lid domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A7I7K8
Sequence length 345
Comment (tr|A7I7K8|A7I7K8_METB6) Peptidase M42 family protein {ECO:0000313|EMBL:ABS55719.1} KW=Complete proteome; Reference proteome OX=456442 OS=Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8). GN=Mboo_1201 OC=Methanoregulaceae; Methanoregula.
Sequence
MVKELLRKLSNAHGVSGSEGSVFALIKKELKGCVDEITEDPMGNLIAVRHGNKSKVMLAA
HMDEIGLMVKYIDDKGFLRFITLGGWYGPTLYNQRVIVHGTKGDRIGVIGGKPPHMMDED
ERKKGVKTDDMFIDIGAKNKDDVAELGIEVGTPVTIDREFTELANNRVTGKAFDNRAGVA
MLIKTMQKMKSPFTVYAVFTVQEEVGLKGAKTSAYTIDPDWAIATDVTIPGDHPGIDMKD
AAVEMGKGPVITIVDSSGRGLIASRKVVQWLKNAAETNAIPVQYEVGTGGTTDATSIHLS
RGGVPSTTISPPTRYIHSPVEVLDTGDIEAGVNLLVAALKTKPAL
Download sequence
Identical sequences A7I7K8
456442.Mboo_1201 WP_012106750.1.2930 gi|154150744|ref|YP_001404362.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]