SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A7I9Q7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7I9Q7
Domain Number 1 Region: 1-92
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 8.33e-30
Family Ribosomal protein L44e 0.0000654
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A7I9Q7
Sequence length 92
Comment (tr|A7I9Q7|A7I9Q7_METB6) 50S ribosomal protein L44e {ECO:0000256|HAMAP-Rule:MF_01476} KW=Complete proteome; Reference proteome OX=456442 OS=Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8). GN=Mboo_1953 OC=Methanoregulaceae; Methanoregula.
Sequence
MKMPAKFKTYCPFCRNHQIHEVEKVKKSKTTGLHWIDRQKARRGKVGNMGKFSKVPGGDK
PTKKINVRYRCTTCGKAHLRKGFRVAKFELTE
Download sequence
Identical sequences A7I9Q7
gi|154151493|ref|YP_001405111.1| 456442.Mboo_1953 WP_012107523.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]