SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A7IKY5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7IKY5
Domain Number 1 Region: 576-1025
Classification Level Classification E-value
Superfamily ALDH-like 1.11e-118
Family ALDH-like 0.000000889
Further Details:      
 
Domain Number 2 Region: 198-543
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.18e-116
Family Proline dehydrohenase domain of bifunctional PutA protein 0.000000000447
Further Details:      
 
Domain Number 3 Region: 30-197
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 1.27e-59
Family N-terminal domain of bifunctional PutA protein 0.00000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A7IKY5
Sequence length 1221
Comment (tr|A7IKY5|A7IKY5_XANP2) L-glutamate gamma-semialdehyde dehydrogenase {ECO:0000256|PIRNR:PIRNR000197} KW=Complete proteome; Reference proteome OX=78245 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2). GN=Xaut_3449 OC=Xanthobacteraceae; Xanthobacter.
Sequence
MIPAVAAPWAVPETAPLFAEFAPRSSPPLPLRAAFAAAHRRPERAAVADLLPAARLPPEL
RERIAARAGDLVTRLRARPRGSVVAALVQEYALSSQEGVALMCLAEALLRIPDSATRDAL
IRDKIGHGDWQAHLGGGRSLFVNAATWGLVLTGRLTATADDGRLSSALTRLVARCGEPLI
RRAVDMAIGLMGAEFVMGRTIEEALHRAGRREAQGFSYSFDMLGEAAMTAADAERYFAAY
AAAIEAIGKAAGGRGIHAGPGISVKLSALHPRYARAKAGRVMAELLPRLQRLALLARRHD
IGLNIDAEEQDRLELSLDLLEALAAHPGLAGWNGIGFVVQAYGKRCPAVLDFIIDLARRT
GRRIMVRLVKGAYWDAEIKRAQVDGMADFPVFTRKVHTDLCYIACARKLLAARDAVFPQF
ATHNAQTLAAIYELAGPDFRVGDYEFQCLHGMGEALYEEVVGPLTRPCRIYAPVGTHETL
LAYLVRRLLENGANSSFVHRLADDSVPLAELIADPAETVAAMADPGAPSPAIAAPRDLYG
SRANSAGLDLSSDAVLAALGETLAASRETPWRAQPAGGGGPARVVRNPGDHRDVVGEVRE
AGAEDVARAVAVARGAAPGWAARTPAERAAPLRAAADMLEAQMPHLLGLIMREAGKSAAN
AVAEVREAVDFLRYYADEATARLTAAHRPLGPVACISPWNFPLAIFTGQVAAALAAGNCV
LAKPAEETPLVAAEAVRLLHAAGIPQDVLQLLPGDGVVGAALVEAPEVAGVMFTGSTQVA
RAIAGVLACRLSPTGRPVPLIAETGGQNAMIVDSSALPEQVVADVLASAFDSAGQRCSAL
RVLCLQEEVADAMLAMLKGAMAELEIGRTDRLAVDVGPVITAEARAGIEGHVAAMAARGF
PIHRLPLPVEAANGTFVAPTLIEISSMADLTHEVFGPVLHVLRWRRADLGRLVDDINATG
YGLTFGLHTRLDETIAAVTGKVQAGNLYVNRNMIGAVVGVQPFGGHGLSGTGPKAGGPLY
LSRLVTGPAFALGAGTADHAALAFADWLDERGRADDGAAVRALAQVVPLGLSLDLPGPAG
ERNTWRLRPRGSLLLLPASERGLMRQIGMALATGNRAVVEAEAGLLSQLADLPPAVAARI
RTEGGDGPFAAALAEGEGARLVAVAQRLAALPGPIVPLHGATGEEIAASPFAFPAHLLLE
EVSLSVNSAAAGGNASLLAVA
Download sequence
Identical sequences A7IKY5
WP_012115425.1.63109 gi|154247377|ref|YP_001418335.1| 78245.Xaut_3449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]