SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A7N1M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A7N1M3
Domain Number - Region: 158-225
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.000769
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A7N1M3
Sequence length 261
Comment (tr|A7N1M3|A7N1M3_VIBCB) Probable membrane transporter protein {ECO:0000256|RuleBase:RU363041} KW=Complete proteome; Reference proteome OX=338187 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120). GN=VIBHAR_01556 OC=Vibrionaceae; Vibrio.
Sequence
MEMIEPTMLLVLALVAFVAGFIDAVAGGGGMLTVPALLSLGLPPHIALGTNKLAASFASS
TAAFTYYRKRLFKPQCWGRAFLATLIGATLGTLFVDAISTEWLEKVLPLIILAAAMYTVF
HKTPQSTHQSPTPEPCPMLNKKQYAQGFTIGFYDGLAGPGTGAFWTVSSMALYRLNILLA
SGLAKAMNFTSNFTSLITFAVLGHINWVLGLTMGVCLMAGAFIGAHSAIRFGSKFIRPVF
VTVVSVLAIKLAYDAWFVGLA
Download sequence
Identical sequences A7N1M3
WP_012127414.1.100291 WP_012127414.1.11576 gi|156973846|ref|YP_001444753.1| 338187.VIBHAR_01556 gi|538263016|gb|AGU94217.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]