SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A7TF78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7TF78
Domain Number 1 Region: 21-91,132-150,179-245,396-439
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 3.66e-25
Family Leukotriene A4 hydrolase N-terminal domain 0.0071
Further Details:      
 
Domain Number 2 Region: 489-741
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.03e-24
Family Leukotriene A4 hydrolase catalytic domain 0.033
Further Details:      
 
Weak hits

Sequence:  A7TF78
Domain Number - Region: 934-1120,1236-1276
Classification Level Classification E-value
Superfamily ARM repeat 0.00322
Family MIF4G domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A7TF78
Sequence length 1495
Comment (tr|A7TF78|A7TF78_VANPO) Uncharacterized protein {ECO:0000313|EMBL:EDO19103.1} KW=Complete proteome; Reference proteome OX=436907 OS=(Kluyveromyces polysporus). GN=Kpol_2000p71 OC=Vanderwaltozyma.
Sequence
MSYSKGATPKSGPSQLSVLEATSNFRTFKIAHQRVSLDVDLAKHSIKGTAEIILIPLIPN
LEYVTLDCKNIKVNDVLIENRRCDNYIHDDPLRSFAQKYLNSNNDMLYTYNSIEQSHFLR
EKFADLNENPEDRTKSQLTIKIPSSIKITLQDANSLANFTPITPSIRGTPATQESVFTPI
TIKIGYEVNNPTTGVRFDTPSDTQQHLWNAYTTNSELCATATHWMPCINSLDEKSTWEIE
ISVPRKVKDIGTTKIIGQEAEESENPPLQKIKLRTESLSTTTQNNKASGNVEENSKQDAK
KVSDKKDEEIQQDFNQEDKLKTENEEPIEKDDGINKGTEKLQSEPNNEEVVKEETDEGEE
EEEEEDEEEEEEEDEEEDEDEDMLDKEDEDNPLNRDIVVCCSEFSTVKESAHPIDLSKKS
FTFQLFNPVAPHHIGWAIGAFNVWELPSITSREDVYDEEQEETEEKKNGKPGSNEASEMI
ENIEMTDETPIQVYTLPTADVDEETVLNSTIVCQKILDFYSKEFGSYPFTSYSLVFLPTV
VDPTMNFASMTICNTRLLYPRKIIDLMKPTTDFLAWSLAVQWSGVNITPLEDNDIWCCLG
MAGYMVFQLWKKLMGNNELKYRLKMCSERIVEQDWEKPPIGSTFTNASRPISYTSKDLDF
IKLKAPMVLYILDRRMTKTERSFGMSRVLPKIFLQAMSGDLPNNSLSSAHFQHICERVNK
NKLENFFQQWIYGSGVPIFRVTQRFNKKRMVVEMGIRQCQAQELGSGKVTGSSGFSSSAL
NFLEHPTREMAPHFSGSMTIRIHEPDGTPYEHIVEVKDVFTKLDIQYNTKYRRSRARKPL
GARSKKENTPEVSNDINEKYHERDNNTNIQKLGTVLTSPQDCSEWNLTDISVSSEGHELQ
RQGEAFEWIRIDSDFEWISKIYINQPDYMFTSQLQQDGDVEAQIESIRYFEDVVMSSQNN
SKLYSSILTRTIVDSRYFYGVRLEACRALSKFVVRDNESLSFRGGAQHLIKIYQKLFCYE
NSNIPLNNCFSDFKRYYVQQSIPQNLSNVKDERDETPDFIKSFIIDLLTYNENTGNPYDD
TFFVCTLIKAAVKCAINSPSDTNFIGKLLEQLYRYESLDKWTPTYQLLITNTILSEKLKL
NSKKLDRFEDLNSILLYTLSPDALNFNSDAIRMREGLEDIQLVAFKILLVEGGLKNREAL
KYLFESLCFSPNIYIRDKLIDVLYEAIDFVAENGIIDNYDDDIEYMVGKIRPDSNLIEEA
EDDEDDEHHPIVQEDFAEEIEIRRETKLKQHMGGVMSLIRKQFENYYPLKQLMWQTLHMP
GISLYQRKRLFDLSRILFILRDGFQVILPIPRERKLVAKKINEHKIVIKREGLLKLHITS
KVKQPMLPTPDIIAQTPASTAPPANKVKINLKIATKPKKAVSAPAKGKPKKGQVHKVGVL
PIRFVRIHTGQQKRVDLSSVPYSKHVEILKANSRTLSIKIKIPGKKISSKVVPSS
Download sequence
Identical sequences A7TF78
XP_001646961.1.22633 436907.A7TF78 tr|A7TF78|A7TF78_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]