SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A7TJ07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7TJ07
Domain Number 1 Region: 171-261,404-501,930-1140
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 3.53e-45
Family Calcium ATPase, transmembrane domain M 0.042
Further Details:      
 
Domain Number 2 Region: 736-927
Classification Level Classification E-value
Superfamily HAD-like 8.26e-31
Family Meta-cation ATPase, catalytic domain P 0.092
Further Details:      
 
Domain Number 3 Region: 513-757
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1.85e-20
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0093
Further Details:      
 
Domain Number 4 Region: 268-326,362-400
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.11e-16
Family Calcium ATPase, transduction domain A 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A7TJ07
Sequence length 1152
Comment (tr|A7TJ07|A7TJ07_VANPO) Phospholipid-transporting ATPase {ECO:0000256|RuleBase:RU362033} KW=Complete proteome; Reference proteome OX=436907 OS=(Kluyveromyces polysporus). GN=Kpol_1033p9 OC=Vanderwaltozyma.
Sequence
MAFSLPPGPNNGNKVLHYNIRQSNSTDSLDEALDNIHINNLGDTFETQDINNSSYKGDEW
NNDNHNETIELRTISGTESDNNDTIRKSIHSNTRPLLNDPHRDSFDTIADVNNLTNRFSK
ERNFFHKALSSISSGISDGLKKLKSRNSQIRINNKNTERVIKPGNTHLNQKKPYSGNQIS
NAKYHPLTFVPILLYEQFKFFFNLYFLVVALSQAVPVLRIGYLSSYIVPLAFVITVTMLK
EATDDIQRRSRDKELNNELYEVLQKDGQVTSKDLRVGDLIRLKKGSRVPADSVLLQTSEV
TGEAFIKTDQLDGETDWKLRIAPPITQSLQESELIEKTTINASPPEKSIHSFLGKVAVDL
SDSISSPLTIDNTLWANTVVASSGTCIACVVYTGRDTRQSMNTTKSSVKTGLIELEINSL
SKLLCVSVFALSILLVAFAGFHNEDWYIDIMRYLILFSTIIPVSLRVNLDLAKSVYAYQI
EHDNTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNEMQLRKVHLGTVSYTTETTDIVT
EYVSNFVNNSMNGTNSIASRKQIHSRVCDMILSMAICHNVIPTTVEDEITYQAASPDEIA
IVKYTEEVGLTLYKRDRHSMTLLHDSTNEQFQYDILHIFPFNSDSKRMGIIVLDKQNDTY
WFMEKGADSVMSKIVSSNTWLDEEVGNMAREGLRTLVFGRKKLSHKVYEQFSSQYNKASL
EMNNRESQMSDVVSKFLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVE
TARCVSISAKLISRGQYVHTITKLHKPENALNHLEYLYVNRNACLLIDGESLGMYLTYYK
VEFFNAVIHLPSIVACRCTPQQKADIAVLIRDFTGKRVCCIGDGGNDVSMIQCADVGVGI
VGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLSQFVMHRGLVIAICQAVFSI
CSKFEPIALYQGWLMVGYATCYTMAPVFSLTLDTDIKKSLVKVYPELYKDLIEGKSLSYK
TFFVWVTLSIYQGCIIQLFSQVFTGVNETFFLNLVALSFTALVLNETIMVALEISTWNKT
MLITEIVTFIIYVVSVPFLSEYFDLSDFTTLKFYAELILILAVSVFPVWASKSIYRRMHP
PSYAKVQQYSVV
Download sequence
Identical sequences A7TJ07
XP_001645564.1.22633 tr|A7TJ07|A7TJ07_VANPO 436907.A7TJ07

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]