SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A7TKC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7TKC3
Domain Number 1 Region: 105-308
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.46e-48
Family Nitrogenase iron protein-like 0.000004
Further Details:      
 
Domain Number 2 Region: 308-440
Classification Level Classification E-value
Superfamily Signal peptide-binding domain 2.62e-36
Family Signal peptide-binding domain 0.00015
Further Details:      
 
Domain Number 3 Region: 1-98
Classification Level Classification E-value
Superfamily Domain of the SRP/SRP receptor G-proteins 0.000000000000192
Family Domain of the SRP/SRP receptor G-proteins 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A7TKC3
Sequence length 577
Comment (tr|A7TKC3|A7TKC3_VANPO) Signal recognition particle 54 kDa protein {ECO:0000256|RuleBase:RU364034} KW=Complete proteome; Reference proteome OX=436907 OS=(Kluyveromyces polysporus). GN=Kpol_538p10 OC=Vanderwaltozyma.
Sequence
MVLADLGKRINSAVNSALSNTQDDYATAVDILLKNIVTALLEADVNIQLVSKLRANIKAK
LLDQNSNNNNQTSKSGQTKKLIQKTVFDELCNLVDGNTDQQQQFIPKKRKTNIIMFVGLQ
GSGKTTSCTKLAVYYQKRGFKVGLVCADTFRAGAFDQLKQNAIKAHIPFYGSYTEADPVR
VASEGIAKFKKEKFDIIIVDTSGRHRQEEQLFQEMIEISNEIKPNQTIMVLDASIGQAAE
QQSKAFKESSDFGAIILTKMDGHAKGGGAISAVAATNTPIIFIGTGEHIHDLEKFSPKSF
VSKLLGIGDIESLFEQLQTVSNKEDTKATMENIQQGKFTLLDFKKQMQTIMKMGPLSNIT
QMIPGMNNLMNQVGEEETSQKMKKMIYVLDSMTKEELESDGRIFIDQPTRMVRVAKGSGT
SVFEVEMILMQQQMMARMAQSTKAASQQGGMPGMPGMPGMPGMPGMAGMPGMPNIPGMPK
VTPQMMQQAQQRLKQNPNLMQNMMNMFGGGAGGAGGLPGMGAGGMPDMNEMMKMMQDPQM
QQMAKQFRFRNVITILDHNYKQSYHLMYTILIINEIT
Download sequence
Identical sequences A7TKC3
XP_001645108.1.22633 436907.A7TKC3 tr|A7TKC3|A7TKC3_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]