SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A7V5P2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A7V5P2
Domain Number 1 Region: 89-285
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 4.41e-22
Family Lambda integrase-like, catalytic core 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A7V5P2
Sequence length 297
Comment (tr|A7V5P2|A7V5P2_BACUC) Integrase {ECO:0000313|EMBL:EDO53623.1} KW=Complete proteome OX=411479 OS=5828 / NCTC 13054 / VPI 0061). GN=BACUNI_02902 OC=Bacteroides.
Sequence
MGRITINGTQAGFSCKKEVSLALWDVKTNRAKGKSEEARTLNQELDNIKAQITRHYQYIC
DHDSFVTAKKVYNRYVGFSEECHTLMNLFREQLEPYKKKIGIEKAESTYCGLVADYKSLL
LFMKSKKNAEDIVIEELEKSFIEDYYNWMLGTCALANSTVFGRVNTLKWLMYIAQEKGWI
RVHPFASFECMPEYKRRSFLSEEELQRIIHIEPRYKRQRAMRDMFLFMCFTGLSYVDLKA
ITYDNIHTDSDGGTWLMGNRIKTGVAYVVKLLPIAIELIEKYRGTDEKKDSPNVSFR
Download sequence
Identical sequences A0A015Y7E8 A0A016BPM6 A0A078PMU3 A0A078QL11 A0A081UFY0 A0A0P0FJU9 A0A139LNJ3 A0A1Q6JRR9 A7V5P2 B0MUF3 B0NMX8 B3JM64 B7AEV8 C3QIC6 C9KS98 D0TRB0 D1JP13 D4IN05 D4WKC4 D6CWF2 E1WUQ3 E5V958 F7M8E7 I3YNZ7 K1FE54 K1G2I5 R5K7A1 W6NYG5
WP_004289225.1.10083 WP_004289225.1.10223 WP_004289225.1.15203 WP_004289225.1.15557 WP_004289225.1.16618 WP_004289225.1.17938 WP_004289225.1.18542 WP_004289225.1.19523 WP_004289225.1.19590 WP_004289225.1.2011 WP_004289225.1.20771 WP_004289225.1.20997 WP_004289225.1.26971 WP_004289225.1.29471 WP_004289225.1.30930 WP_004289225.1.31541 WP_004289225.1.39319 WP_004289225.1.43182 WP_004289225.1.43770 WP_004289225.1.44367 WP_004289225.1.456 WP_004289225.1.48703 WP_004289225.1.48748 WP_004289225.1.49999 WP_004289225.1.55270 WP_004289225.1.56960 WP_004289225.1.5868 WP_004289225.1.5909 WP_004289225.1.61830 WP_004289225.1.665 WP_004289225.1.67423 WP_004289225.1.72730 WP_004289225.1.77492 WP_004289225.1.77561 WP_004289225.1.79765 WP_004289225.1.82909 WP_004289225.1.84583 WP_004289225.1.84965 WP_004289225.1.91000 WP_004289225.1.91849 WP_004289225.1.94315 WP_004289225.1.94328 WP_004289225.1.94953 WP_004289225.1.97929 gi|375358084|ref|YP_005110856.1| gi|479186732|ref|YP_007817078.1| gi|390947640|ref|YP_006411400.1| gi|479163351|ref|YP_007792085.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]