SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8ACB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A8ACB0
Domain Number - Region: 120-164
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0125
Family FIS-like 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8ACB0
Sequence length 169
Comment (tr|A8ACB0|A8ACB0_IGNH4) Uncharacterized protein {ECO:0000313|EMBL:ABU82562.1} KW=Complete proteome; Reference proteome OX=453591 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125). GN=Igni_1386 OC=Desulfurococcaceae; Ignicoccus.
Sequence
MRLVWDYENGVVIDIETGEVVDYIVDFYVSEERFADKRVGSKISEEERALLKGTEIVKEL
NERGYRDVRGTFVQYKLGLTNKTVKSLEKVERLPEVPAELRTDFEYYLKLIERDPVLSAR
PKRSKHLMALVCAYVVNGKNVREVSKRYNVGEKTLRKLLALARERIIRT
Download sequence
Identical sequences A8ACB0
WP_012123526.1.33635 gi|156938173|ref|YP_001435969.1| 453591.Igni_1386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]