SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8AM36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8AM36
Domain Number 1 Region: 180-395
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 5.31e-74
Family Type II restriction endonuclease catalytic domain 0.0000000554
Further Details:      
 
Domain Number 2 Region: 4-173
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.02e-59
Family Type II restriction endonuclease effector domain 0.000000408
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8AM36
Sequence length 400
Comment (tr|A8AM36|A8AM36_CITK8) Uncharacterized protein {ECO:0000313|EMBL:ABV14549.1} KW=Complete proteome; Reference proteome OX=290338 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696). GN=CKO_03469 OC=Enterobacteriaceae; Citrobacter.
Sequence
MMSGLHSWLLDKSTSDTYMFIKRLSANDTGATGGHQVGIYIPSGIVEHLFPSINHTRDLN
PSVMLNAHTSSHNCPDSEARAIYYNGRFFGKTRNEKRITRWGGGKNPLQDPENTGALALL
AFDHHQGSDSQFVDIWVCHNAEEEDIVESSLGEIVPGSLVYGPANEILGGLALKEPVSSG
YRLPEEWRTNFPSGKEIIQYAAAHYSPNVIGPDKQLIERRRVEYEIFLLVEEMHVLGIVQ
SGFGSVNEFIALANSVSNRRKSRAGKSLELHLEQLFNEHGLKTFETQAVTEGNKKPDFLF
PSAQAYHDEAFPEQKLRMLAVKTTCKDRWRQILNEADRIQDIYLFTLQEGVSVAQFQEMQ
QERVRLVVPSSLHDKYPKAIREYLISLETFIDETKSLYVD
Download sequence
Identical sequences A8AM36
290338.CKO_03469 gi|157147666|ref|YP_001454985.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]