SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8ERC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8ERC3
Domain Number 1 Region: 13-302
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.35e-49
Family Methylenetetrahydrofolate reductase 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8ERC3
Sequence length 303
Comment (tr|A8ERC3|A8ERC3_ARCB4) Methylenetetrahydrofolate reductase {ECO:0000256|RuleBase:RU003862} KW=Complete proteome; Reference proteome OX=367737 OS=Arcobacter butzleri (strain RM4018). GN=Abu_0220 OC=Campylobacteraceae; Arcobacter.
Sequence
MFKTLIQKLQEDKYLTLETTPQHEPSMHNIIEKIKKFNLQDKIDGFSCTDNPLAKLRYNS
LFAALKLQQEFEKPVIATMTMRDRNKIALQSDLLGANDFDVRAILALTGDPAKMSDQPNS
KGVFEANSLMLLKMIKSFNYGMDFAGHPFKIEPKQIFPFAVVNSYAKNFSSLEKKLHLKI
QNGAIGIITQPIFDIENAQKLLESFDIAKENVEGDKRKSQLIFGIFPVTKLRTALFLSAQ
VPGIHVPQFWIDALEKAHSIGEEEEYKVGMELSSNLFKELNKLHPKIHLMTANRFDVANE
IIS
Download sequence
Identical sequences A8ERC3
gi|157736483|ref|YP_001489166.1| 367737.Abu_0220 WP_012012091.1.47628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]