SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8FGT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8FGT7
Domain Number 1 Region: 9-130
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.41e-23
Family Voltage-gated potassium channels 0.00087
Further Details:      
 
Domain Number 2 Region: 115-249
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.87e-16
Family Potassium channel NAD-binding domain 0.0048
Further Details:      
 
Weak hits

Sequence:  A8FGT7
Domain Number - Region: 287-326
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 0.0222
Family TrkA C-terminal domain-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8FGT7
Sequence length 328
Comment (tr|A8FGT7|A8FGT7_BACP2) Potassium channel protein {ECO:0000313|EMBL:ABV63454.1} KW=Complete proteome; Reference proteome OX=315750 OS=Bacillus pumilus (strain SAFR-032). GN=BPUM_2799 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MKSNRIFIAWLRWPLYLRIAVIICFLLLFFGQLIVILEPKQYHTIFDGIWWALITVATVG
YGDFVPQTMPGQIAGMALILIGASFVTAYFATLAAAVFSKQHHYVEGKVAFKGKGHLIII
GWNEKTNKLLQSFQTIDPAMPIVLIDDSLKEGPLLENVHFIKGHGTEDGTLRKANISGAD
ALMITADQHENEVTADMQSVLTLLAAKGLNPSLYCLIEILTDRYVKNAERAGANQVIHTS
DAVNHLMVEHFLLKEQFKALQKKRHMTLHKQVTIIPVPASLTGETFLTALHHFLEHHVIV
VGIQKKEGPMLNPPFDYELHPEDELISL
Download sequence
Identical sequences A8FGT7
gi|157693552|ref|YP_001488014.1| WP_012011077.1.28396 315750.BPUM_2799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]