SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8H406 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8H406
Domain Number 1 Region: 290-462
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000612
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8H406
Sequence length 486
Comment (tr|A8H406|A8H406_SHEPA) Putative beta-barrel assembly-enhancing protease {ECO:0000256|HAMAP-Rule:MF_00997} KW=Complete proteome; Reference proteome OX=398579 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1). GN=Spea_1971 OC=Shewanellaceae; Shewanella.
Sequence
MSKLTFSKSVIAGALSFILCTSSAVTYANNDLPDLGTAAVNTFSLEKETEVGDAYMRVIR
GSAPMLNDPVLNQYLTELGNKLVAHATGVKTPFYFFLLRNDEINAFAFFGGHVGVHTGLF
LNADTESELASVIGHEITHVTQRHLARSIEAQQKTSPATIAGMLGAILLTIASPQAGMAA
LATTQALATQSKINYTRLHEKEADRIGMQVMVDAGFDPNGAADFFGKLATRYRFTTKPPQ
MLLTHPLPESRISEARIRAEQYPHRQIPDNLNFQLAKARIQVRFSGYSEQAALSIFDKQL
KHHRYAFKSAAEYGKALALFRLKKYAESEKIIDELLAKSPNNLFFIDTKTDLLSQRGAQK
EAIELLLTQKQLKPTSQVVNTNLANVYIEDDQISKAIPLLEDLIFLDKQNQLPYFLLNEA
YKKNGNKAMEYFVKAESLALIADYKTAIDQLNFAYRESKDDPLQLARIEARIRQFRQADR
ALEQLQ
Download sequence
Identical sequences A8H406
gi|157961794|ref|YP_001501828.1| 398579.Spea_1971 WP_012155211.1.79101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]