SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8H8N1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8H8N1
Domain Number 1 Region: 5-92
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000216
Family Anti-sigma factor antagonist SpoIIaa 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8H8N1
Sequence length 97
Comment (tr|A8H8N1|A8H8N1_SHEPA) SpoIIAA family protein {ECO:0000313|EMBL:ABV88918.1} KW=Complete proteome; Reference proteome OX=398579 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1). GN=Spea_3605 OC=Shewanellaceae; Shewanella.
Sequence
MVSFNQQGINCTVSGCLDQEAVRSLWNGRSSILDPDTAFLWLSEIEYCDSAGVAFLLELV
STFAAKGASLKLVSPSEQLKKFIILYDLNDFFIEEAK
Download sequence
Identical sequences A8H8N1
WP_012156802.1.79101 398579.Spea_3605 gi|157963419|ref|YP_001503453.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]