SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8HRA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8HRA7
Domain Number 1 Region: 84-371
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.96e-43
Family Cystathionine synthase-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8HRA7
Sequence length 471
Comment (tr|A8HRA7|A8HRA7_AZOC5) Selenocysteinyl-tRNA(Sec) synthase {ECO:0000256|HAMAP-Rule:MF_00423} KW=Complete proteome; Reference proteome OX=438753 OS=NBRC 14845 / NCIMB 13405 / ORS 571). GN=AZC_1155 OC=Xanthobacteraceae; Azorhizobium.
Sequence
MSSGSSVADVSALRRLPSVDQVLKAGPALAAVERFGRAEATEAVRTALDAARAALRAGTP
APVDAEGIAAAALAALAADARASLCPVFNLTGTVLHTNLGRALLAEEAVEAAVAAMRSAV
ALEYDLDSGKRGERDDHVRDLLCRLTGAEDATVVNNNAAAVLLVLNTLAAGRDSIVSRGE
LIEIGGAFRMPDIMARAGTRLVEVGTTNRTHPKDYRGALSPETGLIVKVHTSNYRIEGFT
AEVPPKELAAIGHEAHVPLFNDLGSGTLADLAAYGLVHEPTVREAVAEGADIVTFSGDKL
LGGPQTGFIVGRRDLIAAINKNPMKRALRVDKIRLAALEATLKLYLDPDRLARRLPTLRL
LTRQPAEMAAVAARVRPVLAAKLGEAFTIEERACKSQIGSGALPLETLASTALALIPADG
SGRRLAALADALRGLPVPVVGRVEDGALLLDLRCLEDEAGFAASLAHLEPA
Download sequence
Identical sequences A8HRA7
438753.AZC_1155 WP_012169686.1.27236 gi|158422779|ref|YP_001524071.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]