SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8ICZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8ICZ4
Domain Number 1 Region: 65-449
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.97e-59
Family Cystathionine synthase-like 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8ICZ4
Sequence length 452
Comment (tr|A8ICZ4|A8ICZ4_AZOC5) Putative selenocysteine lyase {ECO:0000313|EMBL:BAF88861.1} KW=Complete proteome; Reference proteome OX=438753 OS=NBRC 14845 / NCIMB 13405 / ORS 571). GN=AZC_2863 OC=Xanthobacteraceae; Azorhizobium.
Sequence
MCRRAEEPWRHGGPDAFPRLTPRGRHRSRHRRRDAHPMGGRDRFAGFRPRSGAAAMMAGP
FTSSEIAELRAQTPATGHRIHLNHASTSLMPRAVTGVMTDFIALEQAVGTHAAMEAHARD
IEGVRHAVAALLNCPPRNIAFVETASRGWALALGACVSSGLRRIALARSDWGANILNASA
MATGTALEVSLVPIGPLGQSSPAALVQAGAGGAVAFSLVPTSSGVAADVETIAEEARRRE
ALVMIDAAQAVGQIPVDVSALGADVLVFPARKWLRGPKGAAVLFVSDRILAQAGPPLRDL
GGGTWSGADDFLWRDDARRFESFEFNPAVRLGLGAAARLAREVGPGRIAARIRALVDLAC
TRLAALGAPLPMEAGDPAATGIMTWADRRRDVGALVEALRQRGIFAAGIGESQARLALEA
RGGPIIRASVHYFNTEDEIEAFATGFAALWHI
Download sequence
Identical sequences A8ICZ4
gi|158424487|ref|YP_001525779.1| 438753.AZC_2863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]