SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8IRB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8IRB5
Domain Number 1 Region: 335-446
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.73e-20
Family cAMP-binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 97-324
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.28e-18
Family Voltage-gated potassium channels 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8IRB5
Sequence length 545
Comment (tr|A8IRB5|A8IRB5_CHLRE) Predicted protein {ECO:0000313|EMBL:EDP04816.1} KW=Complete proteome; Reference proteome OX=3055 OS=Chlamydomonas reinhardtii (Chlamydomonas smithii). GN=CHLREDRAFT_189041 OC=Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas.
Sequence
MAEAETKDLDAGARTKSRVKFADVADEPVKRQETNLSVQHSSKSVRSTRTDTSTWLNSKT
RNRGRRRWRRFVMKLNPRYWIHILNKRLPILMPETRQRRYWDFFVLTLVVWTALVVPFEV
GFGSINFPGGYQIERLIDACFWVDVCLNFRTAYIDHSANMVRDGAKIAGHYIRTWFFVDL
VASIPFDVIVLWFVKDMSSEGLIALGLLRTPRLLRLGRLLRYFDRMKGANIVRMGKLLFF
MALVAHWVSCLWFMLYRITHGNLQWSYDLLTNAKIMTYYVEAYLQSFLLMIGNDINPQRL
YCTGILVIGACFYAIVVGHMSLLVNNMNPTASRHKFKKDIINNTVRYLGAPRDIAGRIDQ
YFDYLTTYSHPGPDGMALISQLPSSMFQDIAIWMYKDLVTKVPLFKECEPAFIAQLVIRL
RLAVFLPSEVIFRIGDVGHEMYFITKCVALCHCDLTLLMAHDLVRAHAVKRLNDMQTAGK
VQATIGRLTGKIEALQGKMGKIHTRLGRVEANPNIFSAGPPMGGMGADPGGANKNIFDVD
FTGGM
Download sequence
Identical sequences A8IRB5
3055.JGI189041 jgi|Chlre4|189041|estExt_fgenesh2_pg.C_130106 XP_001691708.1.80978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]