SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8KXI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8KXI5
Domain Number 1 Region: 20-213
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 3.93e-43
Family DJ-1/PfpI 0.013
Further Details:      
 
Domain Number 2 Region: 284-335
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000333
Family AraC type transcriptional activator 0.042
Further Details:      
 
Domain Number 3 Region: 233-282
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000173
Family AraC type transcriptional activator 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8KXI5
Sequence length 342
Comment (tr|A8KXI5|A8KXI5_FRASN) Transcriptional regulator, AraC family {ECO:0000313|EMBL:ABW11440.1} KW=Complete proteome; Reference proteome OX=298653 OS=Frankia sp. (strain EAN1pec). GN=Franean1_2003 OC=Bacteria; Actinobacteria; Frankiales; Frankiaceae; Frankia.
Sequence
MGPAGSPVGGKQSPGYRPAMHTVAVLALEGVVPFDLAVPVDTFGRARLPDGRAAYRVKIC
AGRSISGTVEADGGAFSLRAPWGLDALAEADTIVVPGVGEQAGPLPPESVTALRAAAARG
TRIASICVGAFLLAQTGLLDGLRATTHWIAAEELARRHPAVRVDPNVLFVDNGQILTSAG
AAAGLDLCLHMIRSDHGVAVAADVARLSVVPLAREGGQAQFIVRDRPPPDGSVLEPLLRW
MEANCHRPLTVDDLAAQAMTSPRTLNRRFREQTGTTPSQWLHRVRLRQAQYLLETTGHSV
ERIAAQVGFGSPTAFRDGFRRLVGTSPQAYRRAFRDAVTPPG
Download sequence
Identical sequences A8KXI5
gi|158313838|ref|YP_001506346.1| 298653.Franean1_2003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]