SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8L281 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8L281
Domain Number 1 Region: 763-965
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.02e-18
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0096
Further Details:      
 
Domain Number 2 Region: 68-217
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000000147
Family Pyruvate oxidase and decarboxylase Pyr module 0.032
Further Details:      
 
Domain Number 3 Region: 450-633
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000589
Family Pyruvate oxidase and decarboxylase PP module 0.045
Further Details:      
 
Domain Number 4 Region: 297-372
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000126
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8L281
Sequence length 1239
Comment (tr|A8L281|A8L281_FRASN) Pyruvate ferredoxin/flavodoxin oxidoreductase {ECO:0000313|EMBL:ABW16172.1} KW=Complete proteome; Reference proteome OX=298653 OS=Frankia sp. (strain EAN1pec). GN=Franean1_6838 OC=Bacteria; Actinobacteria; Frankiales; Frankiaceae; Frankia.
Sequence
MIGATGERAASGDVIEAPPLEGPPVADPPAVEAPVPAPAAAALLSGVETLARLLVVRERL
DAKDGLTTGTMVSGYPGSPLGTFDLTLDKLGDKLAEHRILHRPGLNEELGAAVVWGSQMG
AVNGYAGVDGVAGAWYGKTPGLDRCGDVLRHANAMGAGPNGGVVMFCGDDPTAKSSTLPC
DSQYTFEDACIPVLFPGDQQEVLDLGVHAYRMSRYCGSWAGMKIVTAVADGIGSVDLDLD
RHTPEDPEDILVEGLPWRHRPQAKIGPHAVAGQEALVVDHRLRAAQAYVRHNGLDRVVGA
RAGAPLGIVCAGKTYFDVVQAFSDLGVRPDGLAAAGVRVLKLAMTYPVVESTVVEFARSV
EEILVVEEKRPFIETQLRSILHQAGIMVPVAGKKDLDGRALLSTVGELDPAAVGKALTRV
RPALAAGRRDEPRRMSLPLLALPSRPPGFCSGCPHNRSTIFPDGALVGGGVGCHGIMYFE
TRHQGMTSLPPTPMGAEGVPWIGLAPFVDEPHLIQNLGDGTLSHSGILAIRASVAAGVAV
TFKILYNTAVAMTGGQDVVGLMDVPAMTRALEAEGVRRIVVCAEDPKRYGRRARWAPGVK
VLGRDHLPEVQEELRGVAGVSVIIYDQRCAAESRRLRKRGLLPEPPRRVVINEAVCEGCG
DCGTKSNCLSVLPVETELGVKRRIDDLSCNRDYTCLDGDCPSFVTVQPRSRTWPWTRSPA
KRRARRASAEQAAGASAGTGESVRPTLPAGTLPAPANPGVDGQYGIYVTGIGGTGIITAS
RILAAAAESAGLVVGGVDQTGLSQKAGAVVSHLHLAATRAEIGSATVGPGGADLYLSGDI
LQAAGGPQLERVRPGHTVAVVETELIPTTSMLQGGATAPADEDLRRAITDRVGPERVAFI
AGRQIAEQVFADQLLGNVVLLGAAFQLGGLPFTLDDVENAMRRQGKAAAKNREAFEWGRW
AAHDPAAVEASLAGPAATGPAATGSAGAEASGAGPEPGRRPGLTDPSSAALTRAVALVAE
RPLPPALRDLLVRRAAQVIDYSGDSLARRFLGLVEQASARDDEARGWELTRAVADSWHKI
LTYKDEYEVARLHLKTDYDDVARDLGIDGPYKVTYHLHPPALRRLGMSKKMPMGRPYAVA
FHGLRAMKRLRGTPFDIFGYDPDRRTERAVIAEYEALITELVRPVPAGAAVAYETLVRAA
ESVQSVKGYAEIKEAAVERWRAEIAQLRRDLVPATAGLD
Download sequence
Identical sequences A8L281
298653.Franean1_6838 gi|158318570|ref|YP_001511078.1| WP_020464240.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]