SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8L6Z3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8L6Z3
Domain Number 1 Region: 22-99
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000349
Family Tetracyclin repressor-like, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8L6Z3
Sequence length 212
Comment (tr|A8L6Z3|A8L6Z3_FRASN) Transcriptional regulator, TetR family {ECO:0000313|EMBL:ABW13484.1} KW=Complete proteome; Reference proteome OX=298653 OS=Frankia sp. (strain EAN1pec). GN=Franean1_4097 OC=Bacteria; Actinobacteria; Frankiales; Frankiaceae; Frankia.
Sequence
MTGDGVKRPYRTSPSVRQARADRLEAAARAVESAALQLFELRGFDVVTVDDIAAAARISV
RTFYRYFPAKDDVLRAVVRRRAQAVATALATRPEDEAPMRSVRQAVQDVVAAEDSAEVAR
WVQVVEASLYATRVMLGVSILEFNGVLAEFLGARLGKAPDDLEPAMLAVAAGAIILAAQT
RWYLLGGDLAATISDALTVIDTVVLGGAGASE
Download sequence
Identical sequences A8L6Z3
WP_020461619.1.9268 298653.Franean1_4097 gi|158315882|ref|YP_001508390.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]