SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8LA66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8LA66
Domain Number 1 Region: 7-85
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000359
Family Tetracyclin repressor-like, N-terminal domain 0.0032
Further Details:      
 
Weak hits

Sequence:  A8LA66
Domain Number - Region: 88-211
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0445
Family Tetracyclin repressor-like, C-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8LA66
Sequence length 227
Comment (tr|A8LA66|A8LA66_FRASN) Transcriptional regulator, TetR family {ECO:0000313|EMBL:ABW10946.1} KW=Complete proteome; Reference proteome OX=298653 OS=Frankia sp. (strain EAN1pec). GN=Franean1_1506 OC=Bacteria; Actinobacteria; Frankiales; Frankiaceae; Frankia.
Sequence
MTGKAVRPERGSATRELILNTAERLFAERGVHAVSNRQVSEAAGQSNNAVVSYHFGTKAD
LVRAIARRHADQMEQVRVTLVAEAAGSADLRGWVACLVRPFTEHLAALGSPTWYARFRAQ
VVSDPALHGIAVEESLRSASLRLLLAGLNQCLPDLPADIRTVRWVMARHLIAHMCVERER
ALAEGTPTLEPSWDALAASLIDALVGLWQAPVTPAPPKENAAGKTKR
Download sequence
Identical sequences A8LA66
gi|158313344|ref|YP_001505852.1| 298653.Franean1_1506 WP_020459120.1.9268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]