SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8LAD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8LAD5
Domain Number 1 Region: 68-194
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 2.22e-19
Family Tetracyclin repressor-like, C-terminal domain 0.0094
Further Details:      
 
Domain Number 2 Region: 3-65
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000409
Family Tetracyclin repressor-like, N-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8LAD5
Sequence length 216
Comment (tr|A8LAD5|A8LAD5_FRASN) Transcriptional regulator, TetR family {ECO:0000313|EMBL:ABW12337.1} KW=Complete proteome; Reference proteome OX=298653 OS=Frankia sp. (strain EAN1pec). GN=Franean1_2916 OC=Bacteria; Actinobacteria; Frankiales; Frankiaceae; Frankia.
Sequence
MAQLTRAEIIDAAVELLDQGVEALTMRSLADRLSVTAAALYYWFPAKAQLLDAIAEHVAA
QIVATKERGASWEDRLRSLAMAVFDAAEHHPATFNWVFRNYAMQPPLAKIDEAMLDVLMD
AGFGAREAVLAKSTILRLVVGHLGLVVLPNHIDPSSVDVESYPRAHQVASASAQLSPGDF
LEYGLDHVIASFGSPRRGRQGDSPSGSRTSSANGQI
Download sequence
Identical sequences A8LAD5
gi|158314735|ref|YP_001507243.1| WP_020460489.1.9268 298653.Franean1_2916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]