SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8LCB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8LCB0
Domain Number 1 Region: 15-190
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.33e-43
Family PAPS reductase-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8LCB0
Sequence length 223
Comment (tr|A8LCB0|A8LCB0_FRASN) Phosphoadenylyl-sulfate reductase (thioredoxin) {ECO:0000256|SAAS:SAAS00769130} KW=Complete proteome; Reference proteome OX=298653 OS=Frankia sp. (strain EAN1pec). GN=Franean1_6103 OC=Bacteria; Actinobacteria; Frankiales; Frankiaceae; Frankia.
Sequence
MDAALKARALRAGDELEGAPAEEILQWAADEFGTGLVVAASMAEAVLVDMLARIRSDVPV
VFIDTGYHFAETIGTRDAVAHTYSLPIISARPQLTVVGQDAVHGPRLYESDPDLCCRMRK
IVPLDRALAPYRAWAAGSRRVESAGRKSLPVVGWDQRRGKVKIHPLATWTDEDVERYVQE
HNVIVNPLLSDGYESVGCWPCTQRGAGRDGRWAGTTKTECGIH
Download sequence
Identical sequences A0A1S1PHB9 A8LCB0
gi|158317845|ref|YP_001510353.1| WP_020463528.1.13248 WP_020463528.1.9268 298653.Franean1_6103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]