SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8LCD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8LCD7
Domain Number 1 Region: 116-241
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 5.5e-21
Family N-acetylmuramoyl-L-alanine amidase-like 0.0013
Further Details:      
 
Domain Number 2 Region: 270-352
Classification Level Classification E-value
Superfamily PGBD-like 0.000000000165
Family Peptidoglycan binding domain, PGBD 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8LCD7
Sequence length 361
Comment (tr|A8LCD7|A8LCD7_FRASN) N-acetylmuramyl-L-alanine amidase, negative regulator of AmpC, AmpD {ECO:0000313|EMBL:ABW09576.1} KW=Complete proteome; Reference proteome OX=298653 OS=Frankia sp. (strain EAN1pec). GN=Franean1_0109 OC=Bacteria; Actinobacteria; Frankiales; Frankiaceae; Frankia.
Sequence
MYGSSWDRTRNTESTAWGRPPGRRPRAAAGHPDTTQTRRGTRDSSRPTATGTSSADRDPS
TGGDPSAGRGPKAGRDPTADGVRARGEHERPGLTVAVTLYPPARNRPVRNTSGTMVEPTR
GLIPHVQVGTGSLFGWFDNPASQVSAHLWLSKAGEFEQYVPFDRRAWAQAAGNPFWISVE
CEGYDSEDYTAIQVQRLGELFAWGMREFGWRPEITDSPNGYGLGTHRMGGAAWGGHSCPG
NVRANRRGDILAAALGASPGGSLADPRQRYAGMPTLREGMSGPEVVTLQNALNIIFGHEA
PTGDPYRLAPDGAYGARTTARVASLQRYATPWFGRIPEDGVCGPNTWRKIGYVLTGMNRQ
V
Download sequence
Identical sequences A8LCD7
298653.Franean1_0109 gi|158311974|ref|YP_001504482.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]