SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8LE59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8LE59
Domain Number 1 Region: 185-260
Classification Level Classification E-value
Superfamily PKD domain 0.0000000196
Family PKD domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8LE59
Sequence length 298
Comment (tr|A8LE59|A8LE59_FRASN) Uncharacterized protein {ECO:0000313|EMBL:ABW11194.1} KW=Complete proteome; Reference proteome OX=298653 OS=Frankia sp. (strain EAN1pec). GN=Franean1_1756 OC=Bacteria; Actinobacteria; Frankiales; Frankiaceae; Frankia.
Sequence
MSHRRGHLAALAALVAAALLALSGAGPGPLSAPGSPAWAAPAPGPETAAQVPCTGARWGS
CDTRATDNGYQYRYRGGYLERVPLGGATGGGGGGCGDDCPPDPDALCALLTGVGPAPEMT
AAERAEYDALVANCGPVLYDPDGIAVADIAAQLADYLREELLPTPDVVIQPVGNSFANLP
TIMHTAVPDAFTFDVAEPVLATISANPHYVWDFGDGETGPDAPGRPYDPAISPRDHPDAY
VAHAYHRPGTYQVTLTVTWDGFFTVPGVAQAFPLADVVLAAAEPITIEEAGGVLVDND
Download sequence
Identical sequences A8LE59
WP_020459366.1.9268 gi|158313592|ref|YP_001506100.1| 298653.Franean1_1756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]