SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8LGW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8LGW0
Domain Number 1 Region: 7-79
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000208
Family Tetracyclin repressor-like, N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8LGW0
Sequence length 226
Comment (tr|A8LGW0|A8LGW0_FRASN) Transcriptional regulator, TetR family {ECO:0000313|EMBL:ABW12731.1} KW=Complete proteome; Reference proteome OX=298653 OS=Frankia sp. (strain EAN1pec). GN=Franean1_3328 OC=Bacteria; Actinobacteria; Frankiales; Frankiaceae; Frankia.
Sequence
MPQTSPDRRGRPRGTSARKLELIALRLFAEQGYHETTVDQIAAAAGVSRRTFFRYFDAKS
QVLWNEFDNEVTTIRANLQQTSGGLPVMDAVRHAVIAANYYRAEDVPELRMRMHLISTVP
ELVASATVHYDAWERAITEFVARRTDQPADSLYPLAVGRATLAVCRAAYERWSTHADADL
TLYLDAALRALAAGFRDDILTTEPQGGGTERALGAHPAESAAVRRG
Download sequence
Identical sequences A8LGW0
WP_020460872.1.9268 298653.Franean1_3328 gi|158315129|ref|YP_001507637.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]