SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8LH99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8LH99
Domain Number 1 Region: 93-197
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 2.45e-17
Family Tetracyclin repressor-like, C-terminal domain 0.0069
Further Details:      
 
Domain Number 2 Region: 12-77
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000446
Family Tetracyclin repressor-like, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8LH99
Sequence length 216
Comment (tr|A8LH99|A8LH99_FRASN) Transcriptional regulator, TetR family {ECO:0000313|EMBL:ABW14289.1} KW=Complete proteome; Reference proteome OX=298653 OS=Frankia sp. (strain EAN1pec). GN=Franean1_4924 OC=Bacteria; Actinobacteria; Frankiales; Frankiaceae; Frankia.
Sequence
MVDTAYVTGEGALRRRLVEVGTAMLDEGGTAAVSLRAIARQAGVSHGAPRRHFPTHAALL
AAIAAEGLADLASRLAGVRAAGEAAGASPHECVVDAGSAYVRFARERPAMFELMFRHDIL
VGAGENLRERSLPLFDAWTDLVRAALPAPPAGAGAGAGADPPEQVRRRALLAWTHLHGIA
VLAANESLGLVTASPDPTELVVEAIGVHLCPDAGPR
Download sequence
Identical sequences A8LH99
gi|158316687|ref|YP_001509195.1| WP_020462406.1.9268 298653.Franean1_4924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]