SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8LHC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8LHC1
Domain Number 1 Region: 79-183
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.25e-16
Family FHA domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8LHC1
Sequence length 187
Comment (tr|A8LHC1|A8LHC1_FRASN) FHA domain containing protein {ECO:0000313|EMBL:ABW14311.1} KW=Complete proteome; Reference proteome OX=298653 OS=Frankia sp. (strain EAN1pec). GN=Franean1_4947 OC=Bacteria; Actinobacteria; Frankiales; Frankiaceae; Frankia.
Sequence
MPVTEPVCRACGHNAVTGTGPRAVGVVPLGRAATRAAPEATDGWTSNGSAGTGSAGAAWA
VEIAPDRAYFDRGENDGAVFPTDRAGRIIRMATPRAVIGRRSRSRGQAPELDLSLPPRDP
GVSRSHALLERHADGTVTVTDLRSANGTWLGPDAAHLARVGVGDSALVREGDHVFVGAWT
RVTVRPR
Download sequence
Identical sequences A8LHC1
WP_020462428.1.9268 298653.Franean1_4947 gi|158316709|ref|YP_001509217.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]