SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8LHD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8LHD8
Domain Number 1 Region: 317-516
Classification Level Classification E-value
Superfamily DNA-glycosylase 2.57e-35
Family DNA repair glycosylase, 2 C-terminal domains 0.00042
Further Details:      
 
Domain Number 2 Region: 5-88
Classification Level Classification E-value
Superfamily Ada DNA repair protein, N-terminal domain (N-Ada 10) 1.18e-31
Family Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.00038
Further Details:      
 
Domain Number 3 Region: 212-308
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.27e-24
Family DNA repair glycosylase, N-terminal domain 0.0062
Further Details:      
 
Domain Number 4 Region: 141-190
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000717
Family AraC type transcriptional activator 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A8LHD8
Sequence length 540
Comment (tr|A8LHD8|A8LHD8_FRASN) Transcriptional regulator, AraC family {ECO:0000313|EMBL:ABW15757.1} KW=Complete proteome; Reference proteome OX=298653 OS=Frankia sp. (strain EAN1pec). GN=Franean1_6420 OC=Bacteria; Actinobacteria; Frankiales; Frankiaceae; Frankia.
Sequence
MPASPHLDAELCARVVRSRDARFDGWFFVAVTSTGIYCRPSCPARPPRTENMRFHPTAAS
AQRAGFRACKRCRPDASPGSPEWNHRADVVARAMRLIVDGVVDREGVPGLAGQLGYSARQ
VERHLSAELGAGPLALARAQRAQTARLLLETTDLSMGDVATAAGFNSIRAFNDTMREVFA
AAPSDLRRRRNPARPPSVVPVPRAATGAVTLTVRLPFRAPLYPDNLFGHLVATAVPGVEE
WRDGAYRRTMRTLHGHAIVALRPLPDHIGCRLALTDVRDLAPVIGRCRRLLDLDADPIAV
DGQLAADPALAPLVARAPGRRVPRTVDPAELAVRAVLGQQVSVAAARTHAARLVTAVGTP
IHDPEGGLTHLWPQIADLAEHIERTEYAECTDLADAVPAGRRAGAPRGLALPAARRRTFA
ALVGGLVSGMIELGAGGDWERARAALAALPGIGPWTLETIAMRALGDPDAFLPGDLGVRR
GAERLGLPATPAALSRHAAAWRPWRAYAVQHLWAVLDHPVNRMPAPDHPGPVTARREERL
Download sequence
Identical sequences A8LHD8
298653.Franean1_6420 gi|158318155|ref|YP_001510663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]