SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8LHG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A8LHG7
Domain Number - Region: 185-233
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0148
Family AraC type transcriptional activator 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8LHG7
Sequence length 239
Comment (tr|A8LHG7|A8LHG7_FRASN) Transcriptional regulator, AraC family {ECO:0000313|EMBL:ABW15786.1} KW=Complete proteome; Reference proteome OX=298653 OS=Frankia sp. (strain EAN1pec). GN=Franean1_6449 OC=Bacteria; Actinobacteria; Frankiales; Frankiaceae; Frankia.
Sequence
MSVTYREYQPPAGLRPVVACTWEHESDEGHTQLVVPDGCMDLIWLSERELVIVGADTGPR
GVSLPGHARSSGIRLRCSAAGAVVGVPASELRDRQVDAASVWGEQAVGLQQALPVAAPAR
RLELLADAVGRRDARPDVLVAAAARRLAVPGARVADVAAELGVGERQLHRRTLAAVGYGP
KMLARVARLRRLVGLRDDSLSSRALRAGYASQAHMNDEVRRLTGSTPVRFLKDAALSAA
Download sequence
Identical sequences A8LHG7
298653.Franean1_6449 WP_020463859.1.9268 gi|158318184|ref|YP_001510692.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]