SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8M0Q3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8M0Q3
Domain Number 1 Region: 72-586
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 1.57e-200
Family Heme-dependent catalases 0.0000000000663
Further Details:      
 
Domain Number 2 Region: 594-742
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.000000000916
Family Catalase, C-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A8M0Q3
Sequence length 748
Comment (tr|A8M0Q3|A8M0Q3_SALAI) Catalase {ECO:0000256|PIRNR:PIRNR038927, ECO:0000256|RuleBase:RU000498} KW=Complete proteome OX=391037 OS=Salinispora arenicola (strain CNS-205). GN=Sare_2202 OC=Salinispora.
Sequence
MDPNKPAKAVEGVVQAAAEEGADVTRADVPGAPGSAPPSVEEPTEPHDPLPSRKEQGTPE
TRTPTGATTGLPPAANGQQGAFLTTAQGARLRDTDHSLKAGPRGPILMQDHHFREKITHF
DHERIPERVVHARGAGAHGVFTSYGAAEVTRAGFLRKGKETPVFVRFSTVLGSRGSADTV
RDTRGFATKFYTDEGNFDLVGNNMPVFFIQDAIKFPDIIHAGKPHPDREIPQAQSAHDTF
WDFVSLHTEAQHHAMWNMSDRGIPRSFRMMEGFGVHTFRLVNAAGETALAKFHWKPKLGV
HSLTWEEAQMISGMDPDFHRRDLYDAIEAGAYPEWELGLQIVPDSPEETFAGVDLLDPTK
FVPEELAPVQPVGMLVLNRMPTNFFAETEQVAFHVGSLVAGIDVTNDPLLQGRLFSYVDT
QLTRLAGPNFPQIPINRPHAPVNDLLRDGFHQQAVHTGVAPYRPNSLDGGNPFPAGDDEN
AFLDVPVTVAEAPKVRANPVSFDDHFSQVRLFWLSMSPVEREHIIRAYTFELSKCYHQEI
KERQLRCLANIDPVLCAQVAAGLGLPAPEPTVPPVDVEPSPALSQLGRTWPTDGRTVGIV
VDADSDLDGVDGVRSAVFAAGMVPLLVAAHGGKVGELPVQRTFATGRATEFDALLLAGAP
APAPDALPAADAGHATLVDPRVRLLVQESWRHAKAIGGWGAGVSVLEQAGVLGTPGVVTG
GSGTDVLAGVQRLMAAHRVWERFPTAVT
Download sequence
Identical sequences A8M0Q3
391037.Sare_2202 WP_012182365.1.69805 gi|159037801|ref|YP_001537054.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]