SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8MB51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8MB51
Domain Number 1 Region: 7-184
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.4e-47
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8MB51
Sequence length 187
Comment (tr|A8MB51|A8MB51_CALMQ) Pyruvate/ketoisovalerate oxidoreductase, gamma subunit {ECO:0000313|EMBL:ABW02680.1} KW=Complete proteome; Reference proteome OX=397948 OS=/ IC-167). GN=Cmaq_1863 OC=Thermoproteaceae; Caldivirga.
Sequence
MEGLSRIDITFYGRGGQGAVTAAQVLAEAAIHSGLFASAFPEYGAERRGAPVRAYVRVAN
QYLGIREPIEKPDVSVVFDTRLIDVFNITKITKPNGTIVINSSEDYAKQMLSQFNGKVVY
VDAYGISMKYLGKAIVNTPMLGALLRVIGMINIEVVKELIRNTFRGRIGQLNAEAIDEAY
KLARVIP
Download sequence
Identical sequences A8MB51
WP_012186899.1.60673 397948.Cmaq_1863 gi|159042418|ref|YP_001541670.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]