SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A8MLF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8MLF5
Domain Number 1 Region: 84-178
Classification Level Classification E-value
Superfamily Ribosomal protein L6 3.36e-37
Family Ribosomal protein L6 0.0000294
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.75e-24
Family Ribosomal protein L6 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8MLF5
Sequence length 179
Comment (sp|A8MLF5|RL6_ALKOO) 50S ribosomal protein L6 {ECO:0000255|HAMAP-Rule:MF_01365} KW=Complete proteome; Reference proteome OX=350688 OS=(strain OhILAs)). GN=Clos_0507; OC=Alkaliphilus.
Sequence
MSRIGLRPIEIPQGVEVKIDEKNFAVVKGPKGTLEQQLSKDMEIKIEENVINVVRPTDNK
KHKSLHGLTRTLLSNMVEGVTKGYEKKLELVGVGYRANKQGDKLVLTLGFSHPIEMVDPE
GITVEVPSQTEIFVKGINKQVVGNYAAKIRELRKPEPYKGKGVKYANEVIRRKVGKTGK
Download sequence
Identical sequences A8MLF5
350688.Clos_0507 WP_012158383.1.49300 gi|158319558|ref|YP_001512065.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]